3.05 Rating by CuteStat

villany-szerelo.hu is 1 decade 5 years old. It is a domain having hu extension. It has a global traffic rank of #23983179 in the world. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, villany-szerelo.hu is SAFE to browse.

PageSpeed Score
83
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 20
Daily Pageviews: 40

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 23,983,179
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

84.2.38.70

Hosted Country:

Hungary HU

Location Latitude:

47.4919

Location Longitude:

19.05
Villanyszerelő, villanyszerelés, villanyszerelők Budapesten

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 20
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 84.2.38.70)

Kerékpár Webáruház - Kerékpár Webshop - BBBIKE Kerékpárbolt

- bbbike.hu

Különleges kerékpár akciók a 18. kerületben, Magyar gyártású kerékpárok, kerékpár választási tanácsok vásárláshoz, kerékpár szerviz.

Not Applicable $ 8.95

Keresztény Dekoráció

- keresztenydekor.hu

Ihre Bank für Finanzdienstleistungen im Raum Wiesbaden, Taunusstein, Bad Schwalbach und im vorderen Rheingau.

8,380,406 $ 8.95

Link-gyűjtemény.eu | A hasznos linkek gyűjteménye!

- link-gyujtemeny.eu
1,817,270 $ 480.00


Netkapu Linkgyűjtemény | Linkgyűjtemény linképítőknek

- netkapu.com

Linkgyűjtemény, linkkatalógus releváns kategóriákkal.

4,270,261 $ 240.00

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Mon, 19 Jun 2017 11:29:51 GMT
Server: Apache
Last-Modified: Sun, 23 Nov 2014 11:09:04 GMT
ETag: "1298b52-4be4-50884b4b61d0a"
Accept-Ranges: bytes
Cache-Control: max-age=0, private, no-store, no-cache, must-revalidate
Expires: Mon, 26 Jun 2017 11:29:51 GMT
Vary: Accept-Encoding,User-Agent
Content-Encoding: gzip
Content-Length: 5502
Connection: close
Content-Type: text/html

Domain Information

Domain Registrar: Everest 49, LLC
Registration Date: Mar 10, 2009, 12:00 AM 1 decade 5 years 2 months ago

Domain Nameserver Information

Host IP Address Country
dns1.1x1domainhosting.com 84.2.38.70 Hungary Hungary
dns2.1x1domainhosting.com 80.249.171.46 Hungary Hungary

DNS Record Analysis

Host Type TTL Extra
villany-szerelo.hu A 86399 IP: 84.2.38.70
villany-szerelo.hu NS 86399 Target: dns1.1x1domainhosting.com
villany-szerelo.hu NS 86399 Target: dns2.1x1domainhosting.com
villany-szerelo.hu SOA 86399 MNAME: atma.silihost.hu
RNAME: hostmaster.villany-szerelo.hu
Serial: 2016041159
Refresh: 28800
Retry: 7200
Expire: 604800
Minimum TTL: 86400
villany-szerelo.hu MX 86399 Priority: 10
Target: mail.1x1domainhosting.hu

Similarly Ranked Websites

Home - Cityof7lakes.com-All about Lekhnath

- cityof7lakes.com

Lekhnath\'s Complete Portal. Cityof7lakes.com is created for an attempt to introduce Lekhnath Worldwide. All about Lekhnath. लेखनाथ नगरपालिका।

23,983,188 $ 8.95

Informatics Education

- informaticsed.org
23,983,188 $ 8.95

403 Forbidden

- happymothersday2016wishesquotes.com
23,983,199 $ 8.95

Tampa Criminal Defense Attorney | DUI Lawyer in Tampa

- tampaflcriminaldefenselawyers.com

The Tampa criminal defense lawyer at The Law Office of Timothy Hessinger has more than 15 years of invaluable experience as a former state prosecutor. Call our team for powerful advocacy!

23,983,208 $ 8.95

GaussianWaves

- gaussianwaves.blogspot.com
23,983,249 $ 8.95

Full WHOIS Lookup

% Whois server 2.08d serving the hu ccTLD

domain: villany-szerelo.hu
record created: 2009.03.10 00:01:09
További adatokért ld.:
http://www.domain.hu/domain/domainsearch/
For further data see:
http://www.domain.hu/domain/English/domainsearch/